PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA44G00703
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family HRT-like
Protein Properties Length: 468aa    MW: 53147 Da    PI: 9.795
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA44G00703genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like61.21.5e-19271301131
    HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                 +CGviledGs C+++PvkgRKRC eHKG+Ri
  AA44G00703 271 VCGVILEDGSSCNETPVKGRKRCLEHKGQRI 301
                 7*****************************7 PP

2HRT-like50.92.6e-16323353131
    HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                 iCGvil +  +C+++Pv gRKRCe HKGmRi
  AA44G00703 323 ICGVILPNMKPCNNKPVSGRKRCEDHKGMRI 353
                 8*****************************7 PP

3HRT-like46.94.5e-15438467131
    HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                 +CGv+l +  vC+++PvkgRKRCeeHKGmRi
  AA44G00703 438 TCGVKLYN-RVCEKTPVKGRKRCEEHKGMRI 467
                 7******9.8********************7 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MGYGDGVPFV VVPTVFKRED YKRTKHDAVF SKWQILIGSK DWEDFKEGKD GVGRYRVQNL  60
PTKSFPGLYE LGVAVINQDQ SRKLEADDVL ASYLGQAENV RSRLQSYGRS GAHLRNVNLI  120
HYNETIESPE KKAVTLGLFE DIFSKGGSIL YRWAPMRSKR EAEATEGMLL CTFDYAWNKG  180
SNGERRQLDL LQKLGNGEFM SQRKPGISRV LFPFLKNQVG IKIKGEKHVL KEERKLSCNV  240
DEVKSNFITS ILKFTKSKPQ QVSDKLDSGS VCGVILEDGS SCNETPVKGR KRCLEHKGQR  300
ICRVSPQKQR SRKLEILTDS DVICGVILPN MKPCNNKPVS GRKRCEDHKG MRINAFLFLL  360
NSQDLNKTIK DEKSETVTTH SEVNEEPLIR FCEAITKSGL PCTRNSPKES KRCWQHREKT  420
SDEQSLEVLS PVAVKEVTCG VKLYNRVCEK TPVKGRKRCE EHKGMRII
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200489.20.0effector of transcription2
RefseqXP_002866167.10.0hypothetical protein ARALYDRAFT_918835
SwissprotF4K9330.0ET2_ARATH; Protein EFFECTOR OF TRANSCRIPTION 2
TrEMBLD7MM690.0D7MM69_ARALL; Putative uncharacterized protein
STRINGAT5G56780.10.0(Arabidopsis thaliana)
STRINGscaffold_802235.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29542763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.10.0effector of transcription2